Duf5405 family protein
WebDUF5455 Entrez CDD Structure Protein Help pfam17537: DUF5455 Download alignment Family of unknown function (DUF5455) This is a family of unknown function found in … WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. PLU_RS14615 DUF5405 family protein [] Gene ID: 24170245, updated on 16-Sep-2024. Summary. …
Duf5405 family protein
Did you know?
WebSep 29, 2024 · Download alignment. 4F5 protein family. Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine. Although the function … WebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. …
WebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. AT03_RS01125 DUF5405 family protein [] Gene ID: 24189477, discontinued on 31-Jul-2024. Summary. Other … WebThis domain family is found in Enterobacteriaceae. This protein may have a phage origin being found in bacteriophage P2. The majority of proteins have a conserved cysteine residue close to their C-terminus which may have functional significance.
WebView protein in InterPro IPR035404 DUF5405 Pfam View protein in Pfam PF17399 DUF5405 1 hit MobiDB Search… ProtoNet Search… Sequence Length 100 Mass (Da) 11,356 Last updated 1995-02-01 v1 Checksum 89CBA88D015642CA MFCSRAVVLLNNALKIAVMKNGDLSLIQLGLDKEKREITESVIAIYQSELNLLSDVVNLLVKRAVFHKQISSVDELTKLTTEIASYCADEFKKLNDKRNW … WebDUF538 protein super family includes a number of plant proteins that their role is not yet clear. These proteins have been frequently reported to be expressed in plants under various stressful stimuli such as bacteria and elicitors. In order to further understand about this protein family we utilize …
WebTry our new Genome page and use the feedback button to let us know what you think
WebNational Library of Medicine 8600 Rockville Pike. Web Policies FOIA. Help Accessibility Careers inga arvad picturesWebWe'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2024 ... mitch\\u0027s landscapingWebOct 9, 2009 · The structure of Thermotoga maritima protein TM841, a protein from the family formerly called DUF194 (renamed DegV; PF02645), has been solved (Schulze … ingaas coefficient of thermal expansionWebDUF5405 family protein. Gene provides a unified query environment for genes defined by sequence and/or in NCBI's Map Viewer. DDA3937_RS04160 DUF5405 family protein [] Gene ID: 9732280, updated on 8-Feb-2024. Summary. … ingaas comsolWebProtein knowledgebase. UniParc. Sequence archive. Help. Help pages, FAQs, UniProtKB manual, documents, news archive and Biocuration projects. UniRef. Sequence clusters. Proteomes. Protein sets from fully sequenced genomes. Annotation systems. Systems used to automatically annotate proteins with high accuracy: UniRule (Expertly curated rules) ingaas band structureWebProtein family/group databases. TCDB. 9.A.49.1.3 the prenylated rab acceptor protein 1 (pra1) family; Names & Taxonomy. Protein names. Recommended name. PRA1 family protein 3. Alternative names. ADP-ribosylation factor-like protein 6-interacting protein 5 (ARL-6-interacting protein 5; Aip-5) ingaas camera applicationWebDUF5405 family protein 3800 M: M.Sbo268ORF2744P (99% identity) M.KmiBD50ORF3800P: 3805 replication endonuclease 6960 ATP-binding protein ... DUF977 family protein plasmid pBD-50-Km_3 : 32860 73 aa hypothetical protein 32865 M: M.Rte9185ORF7915P (100% identity) M.KmiBD50ORF32865P: 32870 76 aa … ingaas detector array